PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 350aa    MW: 38815 Da    PI: 6.0968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015376genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.84.3e-074341848
                     HTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 18 qlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + G g+W++ +++ g+ R++k+c++rw +yl
      Lus10015376  4 ETGHGSWRALPSKAGLQRCGKSCRLRWTNYL 34
                     568899***********************97 PP

2Myb_DNA-binding50.16.5e-164085148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+++ +E++ +++++++lG++ W++Ia ++  +Rt++++k++w+++l
      Lus10015376 40 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLS-KRTDNEIKNYWNTHL 85
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.934134IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.0E-14341IPR009057Homeodomain-like
SuperFamilySSF466893.1E-202094IPR009057Homeodomain-like
PROSITE profilePS5129424.9223589IPR017930Myb domain
SMARTSM007171.5E-153987IPR001005SANT/Myb domain
PfamPF002495.4E-154085IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-254289IPR009057Homeodomain-like
CDDcd001672.83E-104285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MTEETGHGSW RALPSKAGLQ RCGKSCRLRW TNYLRPDIKR GKFSLQEEQT IIQLHALLGN  60
RWSAIATHLS KRTDNEIKNY WNTHLKKRLS KMGIDPVTHK PKNDTLSNTT QSDLGGAGSV  120
MINSKSAANL SHMAQWESAR LEAEARLVRQ SKLLSLHSFS AASTSASSMI VKAEPPPPPP  180
HHHHHHEHDW TDQLAISCCS SMEGGGGGGG PWSPDNENDN IHHHHHDSSY DKDNNNNNST  240
THNHDDSVAE EGFINLLLSA DHHQEDNDDN NNNNCANAVA EEEEEMKQQD STSTTDNNST  300
GRSTSTSTGG DHDCCYEEED INNKNYWNTI LNLVDTSPPS TDDHHTPIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-1618921108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459338.12e-87PREDICTED: myb-related protein 306-like
TrEMBLL7XCS23e-90L7XCS2_9LAMI; Mixta-like 2.3 protein (Fragment)
STRINGBra021483.1-P3e-84(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.19e-79myb domain protein 106